PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10033825m
Common NameCICLE_v10033825mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 122aa    MW: 14435.6 Da    PI: 10.7536
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10033825mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.14.6e-291870254
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                     prlrWtpeLH++F +ave+LGG+ kA Pk+il++m+vkgL l+h+kSHLQ+YR
  Ciclev10033825m 18 PRLRWTPELHKHFSQAVERLGGKYKASPKRILHMMNVKGLKLSHIKSHLQMYR 70
                     8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-271571IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-221871IPR006447Myb domain, plants
SuperFamilySSF466893.23E-141872IPR009057Homeodomain-like
PfamPF002491.4E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MRNSQRTGVR QYNKSELPRL RWTPELHKHF SQAVERLGGK YKASPKRILH MMNVKGLKLS  60
HIKSHLQMYR NLKNHNGDIT LTMKNLQMQR AQCNNHGVLS ICSPQAHRPV ENEYTADWEY  120
ER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006485154.16e-89PREDICTED: uncharacterized protein LOC102621802
SwissprotQ700D91e-25MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLV4SRB22e-88V4SRB2_9R
STRINGVIT_12s0028g00980.t011e-35(Vitis vinifera)
STRINGGLYMA02G45231.12e-34(Glycine max)
STRINGPOPTR_0002s05770.13e-34(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-27G2-like family protein